PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_35923_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 272aa    MW: 31388.6 Da    PI: 8.9327
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_35923_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33.1e-1974127356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+ ++t++qle Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrRa++k
  Neem_35923_f_1  74 KKKRLTSDQLESLERSFQEEIKLDPDRKMKLSRELGLQPRQIAVWFQNRRARWK 127
                     56779************************************************9 PP

2HD-ZIP_I/II1154.4e-3773156184
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                     ekk+rl+++q+++LE+sF+ee kL+p+rK++l+reLglqprq+avWFqnrRAR+k+kqlE  y+aLk++yd +++++++L++ev
  Neem_35923_f_1  73 EKKKRLTSDQLESLERSFQEEIKLDPDRKMKLSRELGLQPRQIAVWFQNRRARWKSKQLELLYDALKQEYDVVSRDKQKLQQEV 156
                     69*******************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.13E-1964131IPR009057Homeodomain-like
PROSITE profilePS5007117.4169129IPR001356Homeobox domain
SMARTSM003891.5E-1772133IPR001356Homeobox domain
CDDcd000862.39E-1674130No hitNo description
PfamPF000461.2E-1674127IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-2079128IPR009057Homeodomain-like
PRINTSPR000315.2E-5100109IPR000047Helix-turn-helix motif
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
PRINTSPR000315.2E-5109125IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MDWNANLRAF VPVTRPETTS FDFLYNYNYD HFPGAMEMKQ HEAIAIAEKS IGFIPGAAAA  60
MEKNNMMNYG SQEKKKRLTS DQLESLERSF QEEIKLDPDR KMKLSRELGL QPRQIAVWFQ  120
NRRARWKSKQ LELLYDALKQ EYDVVSRDKQ KLQQEVIIHH SPCMHAHPST RIYPLKNWFQ  180
VIKLKSMLRE QGRRNKQVST GMTEVSGEET VESTSVAAVG NSNVEPRTSP SPRVGNPHQN  240
NIADCNYLFN VEEYNPAAVS SPFWSVMPAT YQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121129RRARWKSKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430338.19e-97hypothetical protein CICLE_v10012525mg
RefseqXP_006482366.19e-97PREDICTED: putative homeobox-leucine zipper protein ATHB-51
TrEMBLV4S7W91e-96V4S7W9_9R
STRINGPOPTR_0006s11890.12e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16602888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.11e-49homeobox 51